Home Editor's Choice Reviews News Alternatives TopTens Pre-Register Limited-Time Sale Hot Games Hot Apps Category APK Downloader APK Upload Chrome Extension APKFab APP Search App
Select Language

Pawan Kalyan Wallpapers HD

1.0 23

v1.3 by bmks services

About PawanKalyanWallpapersHD

PawanKalyanWallpapersHD (Package Name: com.bmksservices.pawankalyanwallpapershd) is developed by bmks services and the latest version of Pawan Kalyan Wallpapers HD 1.3 was updated on January 30, 2021. Pawan Kalyan Wallpapers HD is in the category of Personalization. You can check all apps from the developer of Pawan Kalyan Wallpapers HD. Currently this app is for free. This app can be downloaded on Android 4.0.3+ on APKFab or Google Play. All APK/XAPK files on APKFab.com are original and 100% safe with fast download.
Power Star Pawan Kalyan Wallpapers HD app is combo app for not only set the Pawan Kalyan wallpaper but also we can save selected Pawan Kalyan image to gallery and at the same time we can share the Pawan Kalyan images.
Pawan Kalyan got his fame from the Gokulamlo Seetha, Suswagatam, Thammudu, Badri, Jalsa, Attarintiki Daredi, Agnathavasi, Tholiprema, Jonny, Bangaram..etc telugu movies in Tollywood.
In March 2014 Power Star Pawan Kalyan ventured into politics, founding the Jana Sena Party. During that period, Pawan Kalyan was listed by Google as the most searched Indian celebrity politician on Google Search.
You can express your love towards Pawan Kalyan with others by sharing these Pawan Kalyan wallpapers HD!
With this Pawan Kalyan wallpapers HD app we can take you to the beauty world, where you can have number of Pawan Kalyan images.
So come on & get the Pawan Kalyan wallpapers app to personalize your mobile screen with different Pawan Kalyan images.
Features of Pawan Kalyan Wallpapers HD App:
1. You can set the handsome Pawan Kalyan image as wallpaper.
2. You can save your liked Pawan Kalyan wallpaper to your gallery.
3. You can add Pawan Kalyan wallpaper to your favorites and can go through the selected wallpapers easily from your favorites than searching in the entire gallery., so it can save your time.
4. You can share your favorite Pawan Kalyan wallpaper with your friends through watsapp, hike,share it, bluetooth, facebook..etc
Disclaimer
The content provided in this app is available in public domain & Web. We do not upload any images or not showing any modified content. If any image wants to be removed from the App or if any images we linked is unauthorized or violating copyrights., Please send mail to bmpksservices@gmail.com with specific image and We will Remove the image ASAP. Please email us if any images we linked is unauthorized or violating copyrights.
contact email : bmpksservices@gmail.com
Read More
PawanKalyanWallpapersHD Features

Previous Versions

More

Pawan Kalyan Wallpapers HD 1.3 APK January 31, 2021 11.77 MB Download

Requires Android: Android 4.0.3+

Screen DPI: 120-640dpi

SHA1: a048f8377e3c7d9ff26836665ce4f623bb9af3b3

Size: 11.77 MB

Pawan Kalyan Wallpapers HD 1.0 APK January 26, 2019 11.78 MB Download

Requires Android: Android 4.0.3+

Screen DPI: 120-640dpi

SHA1: 2c4e4ba93f099dd9815f8fedbbeb63fa2a966bd9

Size: 11.78 MB

More Information

Update Date:

Latest Version:

1.3

Need Update:

Submit latest version

Available on:

Google Play

Requirements:

Android 4.0.3+

Safe to Download

APKFab.com and the download link of this app are 100% safe. All download links of apps listed on APKFab.com are from Google Play Store or submitted by users. For the app from Google Play Store, APKFab.com won't modify it in any way. For the app submitted by users, APKFab.com will verify its APK signature safety before release it on our website.

Share
Share this page with your friends if you find it useful